Deal score
Domain rating
Backlinks
Organic traffic
Current bid
Auction ends
DR-0 authority for $1 · 453 referring domains · real content since 2024
Auction ended
$2
below valuation
1
competing bids
Auction ended
remaining
adarshavidyalayamazbat.com actively served as the official web portal for an educational institution, hosting school reports, event schedules, and administrative pages.
SEO value
High local institutional relevance with established student and parent search traffic.
No traffic history recorded.
Wayback captures by year
No keywords recorded.
Backlink quality
Recorded backlink quality is 16/100.
Marketplace content flag
GoDaddy content classification is not available.
Archive continuity
Largest recorded archive gap is 63 days.
Actual links pointing to this domain
| Source page | DR | Anchor and target | Type | Status | |
|---|---|---|---|---|---|
ed Before Discovering SEOExpress.org, My E-Commerce Store Was Stuck at Low Single-Digit Visitors Per Day and I Felt Hopeless. Their Expert Keyword Research Helped Me Find Long-Tail Options, and Soon Enough My Daily Visitors Jumped to Nearly One Thousand! A Game Changer for Sales Growth! 💰 ★★★★★ — Editorial Link Link Building And Organic Traffic Hub editorial-link-link-building-and-organic-traffic-hub.store | 32 | I remember when adarshavidyalayamazbat.com was struggling to attract visitors and felt like a ghost site. After discovering SEOExpress.org, I decided to invest in their keyword research service. In three months, my organic traffic skyrocketed from 100 monthly visitors to over 2,800! It’s incredible what targeted SEO can do for your business; I can’t recommend SEOExpress.org enough 📈adarshavidyalayamazbat.com | Raw HTML | Indexed | |
de Before Discovering SEOExpress.org, My E-Commerce Store Was Stuck at Low Single-Digit Visitors Per Day and I Felt Hopeless. Their Expert Keyword Research Helped Me Find Long-Tail Options, and Soon Enough My Daily Visitors Jumped to Nearly One Thousand! A Game Changer for Sales Growth! 💰 ★★★★★ — Definitive Team Link Baron Wiki definitive-team-link-baron-wiki.store | 32 | I remember when adarshavidyalayamazbat.com was struggling to attract visitors and felt like a ghost site. After discovering SEOExpress.org, I decided to invest in their keyword research service. In three months, my organic traffic skyrocketed from 100 monthly visitors to over 2,800! It’s incredible what targeted SEO can do for your business; I can’t recommend SEOExpress.org enough 📈adarshavidyalayamazbat.com | Raw HTML | Indexed | |
di Before Discovering SEOExpress.org, My E-Commerce Store Was Stuck at Low Single-Digit Visitors Per Day and I Felt Hopeless. Their Expert Keyword Research Helped Me Find Long-Tail Options, and Soon Enough My Daily Visitors Jumped to Nearly One Thousand! A Game Changer for Sales Growth! 💰 ★★★★★ — Digital Pr And Domain Rating Premium Experts digital-pr-and-domain-rating-premium-experts.store | 32 | I remember when adarshavidyalayamazbat.com was struggling to attract visitors and felt like a ghost site. After discovering SEOExpress.org, I decided to invest in their keyword research service. In three months, my organic traffic skyrocketed from 100 monthly visitors to over 2,800! It’s incredible what targeted SEO can do for your business; I can’t recommend SEOExpress.org enough 📈adarshavidyalayamazbat.com | Raw HTML | Indexed | |
dy Before Discovering SEOExpress.org, My E-Commerce Store Was Stuck at Low Single-Digit Visitors Per Day and I Felt Hopeless. Their Expert Keyword Research Helped Me Find Long-Tail Options, and Soon Enough My Daily Visitors Jumped to Nearly One Thousand! A Game Changer for Sales Growth! 💰 ★★★★★ — Dynamic Cooperative Link Baron Saas Seo dynamic-cooperative-link-baron-saas-seo.store | 32 | I remember when adarshavidyalayamazbat.com was struggling to attract visitors and felt like a ghost site. After discovering SEOExpress.org, I decided to invest in their keyword research service. In three months, my organic traffic skyrocketed from 100 monthly visitors to over 2,800! It’s incredible what targeted SEO can do for your business; I can’t recommend SEOExpress.org enough 📈adarshavidyalayamazbat.com | Raw HTML | Indexed | |
hi Before Discovering SEOExpress.org, My E-Commerce Store Was Stuck at Low Single-Digit Visitors Per Day and I Felt Hopeless. Their Expert Keyword Research Helped Me Find Long-Tail Options, and Soon Enough My Daily Visitors Jumped to Nearly One Thousand! A Game Changer for Sales Growth! 💰 ★★★★★ — High Backlink Outrank Hq high-backlink-outrank-hq.store | 32 | I remember when adarshavidyalayamazbat.com was struggling to attract visitors and felt like a ghost site. After discovering SEOExpress.org, I decided to invest in their keyword research service. In three months, my organic traffic skyrocketed from 100 monthly visitors to over 2,800! It’s incredible what targeted SEO can do for your business; I can’t recommend SEOExpress.org enough 📈adarshavidyalayamazbat.com | Raw HTML | Indexed |
Websites currently linking to this domain
Referring Domain | ||
|---|---|---|
| No referring domains match these filters. | ||
0 entries
Diversified organic demand
No traffic history recorded.
Keyword | ||
|---|---|---|
| No keywords match these filters. | ||
No data recorded.
No data recorded.
Archive workspace
Archive verdict
Captures run without a material break across the observed span.
First real content
first 200 HTML calc
Last real content
not the last capture
Coverage
of 28 span months
Largest gap
Monthly · UTC · zero months shown
Era classification is inf from the capture mix.
Peak cadence
18/mo calc
Content months
25 calc
Material gaps
0 calc
No captures since calc
Jun 2026 — 77 days and counting.
Not counted as a gap: nothing bounds it on the far side. Absence of captures is not proof the site is down.
Explore historical captures of the domain
URL | Type | View | |||||
|---|---|---|---|---|---|---|---|
| /adarshavidyalayamazbat.com | 06/07/202623:18 UTC | 200 | HTML document | 5.8 KB | 40 | 36 | View |
| /pta.phpadarshavidyalayamazbat.com | 06/07/202622:44 UTC | 200 | HTML document | 4.2 KB | 6 | 6 | View |
| /smdc.phpadarshavidyalayamazbat.com | 06/07/202623:30 UTC | 200 | HTML document | 4.5 KB | 6 | 6 | View |
| /index.phpadarshavidyalayamazbat.com | 06/07/202623:50 UTC | 200 | HTML document | 5.8 KB | 6 | 6 | View |
| /photos.phpadarshavidyalayamazbat.com | 03/08/202600:09 UTC | 200 | HTML document | 4.1 KB | 6 | 6 | View |
| /abt_us.phpadarshavidyalayamazbat.com | 06/07/202623:16 UTC | 200 | HTML document | 4.2 KB | 6 | 6 | View |
| /cbse_rpt.phpadarshavidyalayamazbat.com | 06/07/202622:54 UTC | 200 | HTML document | 4.5 KB | 6 | 6 | View |
| /procedure.phpadarshavidyalayamazbat.com | 06/07/202622:46 UTC | 200 | HTML document | 4.1 KB | 6 | 6 | View |
| /en_cl_wise.phpadarshavidyalayamazbat.com | 06/07/202622:36 UTC | 200 | HTML document | 4.2 KB | 6 | 6 | View |
| /o_comm.phpadarshavidyalayamazbat.com | 06/07/202623:36 UTC | 200 | HTML document | 4.2 KB | 5 | 5 | View |
| /n_staff.phpadarshavidyalayamazbat.com | 06/07/202622:22 UTC | 200 | HTML document | 4.1 KB | 5 | 5 | View |
| /pri_msg.phpadarshavidyalayamazbat.com | 06/07/202622:59 UTC | 200 | HTML document | 4.8 KB | 5 | 5 | View |
| /s_vacancy.phpadarshavidyalayamazbat.com | 06/07/202623:14 UTC | 200 | HTML document | 4.1 KB | 5 | 5 | View |
| /t_vacancy.phpadarshavidyalayamazbat.com | 06/07/202623:55 UTC | 200 | HTML document | 4.0 KB | 5 | 5 | View |
| /aim.phpadarshavidyalayamazbat.com | 03/07/202623:33 UTC | 200 | HTML document | 4.2 KB | 4 | 4 | View |
| /fee.phpadarshavidyalayamazbat.com | 06/07/202622:25 UTC | 200 | HTML document | 4.3 KB | 4 | 4 | View |
| /vision.phpadarshavidyalayamazbat.com | 03/08/202600:00 UTC | 200 | HTML document | 4.5 KB | 4 | 4 | View |
| /contact.phpadarshavidyalayamazbat.com | 04/15/202612:16 UTC | 200 | HTML document | 4.1 KB | 4 | 4 | View |
| /facilities.phpadarshavidyalayamazbat.com | 06/07/202622:27 UTC | 200 | HTML document | 4.4 KB | 4 | 4 | View |
| /notification.phpadarshavidyalayamazbat.com | 03/08/202601:08 UTC | 200 | HTML document | 4.1 KB | 4 | 4 | View |
Showing 1–20 of 21 captures